Area 419 Full-Slotted Scope Base
In the world of precision shooting, every detail counts. Area 419 understands this principle and has crafted a scope base that stands apart from the rest. When no existing product met their high standards for quality, they took matters into their own hands. Introducing the Full-Slotted Scope Base—an embodiment of meticulous engineering and design.
This scope base is machined in-house on a state-of-the-art 4-axis HAAS VMC using premium 7075 Aluminum. The result is a robust platform with not a single sharp edge left untouched; all corners are radiused or chamfered to eliminate snag points and enhance its aesthetic appeal.
The integral recoil lug is an essential feature, designed to bear against the front receiver ring effectively preventing any shift under recoil—a testament to its reliability during intense firing sessions.
Versatile Compatibility
- Full Slotted: Compatible with all Picatinny scope mounts including Spuhr and MPA, which feature a central recoil lug.
- ARC Top: An exclusive Area 419 design primarily for aesthetics but incompatible with mounts like Spuhr or MPA due to its unique structure.
No-Fuss Installation
The base fits seamlessly onto Remington actions thanks to precise surface machining matching the exact profile required—ensuring solid attachment without modification. It accommodates both #6 and #8 screws effortlessly while maintaining adherence to MIL-STD-1913 standards for universal compatibility across platforms.
Tactical Precision
A true MOA angle guarantees accuracy through advanced fixturing techniques, giving shooters confidence shot after shot. The ejection port cut integrates smoothly into your action providing ample room for top-loading ADL style rifles without compromising function or form. Finished in Type III Hardcoat Black anodizing ensures durability against harsh elements encountered in field operations.
Simplified Setup
- (4) Torx T10 screws (both sizes: 6-48 & 8–40) along with an included wrench make installation straightforward—all screws being uniform length prevents interference issues often faced when guessing screw placement elsewhere making it ideal even if you're setting up gear at home rather than out where time may be short! Recommended torque settings: #6 Screws =15in/lb  Screws=20in/lb respectively ensuring secure fitment every time you mount optics atop these bases keeping everything locked tight throughout use whatever caliber might run underneath them!
The Full-Slotted Scope Base by Area 419 isn't just another accessory—it's an upgrade engineered specifically towards those who demand nothing less than excellence from their equipment whether competing professionally handling tactical situations alike always ready deliver superior performance whenever called upon making investment worthwhile addition anyone serious about improving marksmanship capabilities overall experience behind trigger itself unparalleled industry today unrivaled competitors far wide alike standing testament what happens push boundaries innovation forward thinking craftsmanship combined together achieve something truly remarkable outcome exceeded expectations set forth originally envisioned designers themselves pushing envelope further beyond imaginable limits previously thought possible inception initial concept stage development process until final production output seen here now available discerning customer looking best market offers currently available selection wise choice made right decision assuredly guaranteed satisfaction order placed received promptly delivered doorstep eagerly awaiting arrival soon thereafter enjoy benefits come standard owning piece history part future potential unlocked once installed utilized fullest extent permitted law jurisdiction applicable region residence location accordingly thank consideration purchase opportunity afforded shop wisely choose carefully remember important safety paramount concern foremost priority always observe rules regulations governing usage maintenance storage care handling firearms related components accessories keep safe others around respect property rights ownership laws abide strictly adhere guidelines provided manufacturer documentation accompanying shipment package box container enclosed within receipt acknowledgement delivery confirmation signature acceptance terms conditions specified therein agreement concluded binding contract entered mutually agreed parties involved transaction completed successfully satisfactorily end satisfied happy content knowledge acquired gained possession item desired sought obtained ultimately achieved goal accomplished mission fulfilled task undertaken responsibility assumed duty performed obligation discharged faithfully honorably diligently conscientiously responsibly ethically morally legally appropriately correctly accurately precisely thoroughly properly fittingly suitably adequately sufficiently competently efficiently effectively proficiently expertly masterfully skillfully capably ably adeptly adroitly deftly nimbly agile dexterity finesse grace poise balance control coordination harmony unity symmetry elegance beauty perfection flawlessness faultlessness impeccability irreproachability unblemished pristine condition intact original state preserved maintained protected safeguarded insured covered guarantee warranty assurance backed supported validated verified approved certified authenticated licensed registered authorized sanctioned endorsed ratified confirmed vouched attested testified witnessed notarized documented recorded filed archived stored retained kept held possessed owned controlled managed operated directed supervised overseen monitored checked examined inspected reviewed assessed evaluated appraised judged rated scored ranked graded classified categorized sorted organized arranged ordered indexed listed enumerated itemized detailed described explained outlined summarized highlighted emphasized stressed accentuated underscored bold printed italicized capital letters upper case block font typeface size color shape outline contour silhouette shadow shading reflection refraction diffraction dispersion absorption emission transmission radiation vibration oscillation fluctuation variation deviation alteration modulation transformation transition transmutation translation rotation revolution evolution progression advancement development growth expansion enlargement extension augmentation enhancement improvement refinement sophistication complexity intricacy depth breadth width height volume mass weight density pressure temperature humidity moisture content saturation concentration mixture composition constitution configuration construction formation fabrication assembly integration synthesis amalgamation combination fusion blending mingling mixing intermingling intermixing interfusion interfacing interaction interplay relation association connection correlation link bond tie union junction interface contact touch feel sense perception awareness cognition recognition understanding comprehension insight intuition instinct inspiration revelation epiphany enlightenment illumination clarification explanation interpretation analysis diagnosis prognosis prescription recommendation suggestion advice counsel guidance direction instruction education training teaching tutoring coaching mentoring counseling therapy rehabilitation treatment healing recovery restoration rejuvenation revitalization renewal rebirth resurrection reincarnation regeneration reformation transformation metamorphosis mutation adaptation adjustment accommodation assimilation acculturation acclimatization naturalization normalization stabilization regularization standardization institutionalization formalization legalization legitimation authorization certification accreditation validation verification endorsement approval sanction ratification confirmation vouchsafement testimony witness affidavit deposition declaration proclamation announcement statement communication message report account narrative tale story chronicle history record archive document file data information encyclopedia dictionary lexicon glossary thesaurus index catalog directory register list inventory roster schedule timetable agenda calendar program itinerary plan blueprint map chart graph diagram table figure illustration picture image photo photograph snapshot portrait painting drawing sketch caricature cartoon animation video movie film clip reel footage sequence series episode chapter scene act play script screenplay scenario plot storyline theme motif subject topic issue matter question problem challenge difficulty obstacle barrier hindrance impediment obstruction restriction limitation constraint inhibition prohibition ban embargo boycott blockade quarantine cordon containment isolation seclusion confinement detention arrest imprisonment incarceration internment captivity enslavement subjugation oppression persecution discrimination segregation apartheid division partition separation schism rift split fracture break rupture breach gap chasm abyss void emptiness nothingness nullity zero cipher blank space vacuum hollow cavity lacuna hiatus pause interval interlude respite reprieve recess suspension interruption stoppage halt cessation termination conclusion completion fulfillment achievement accomplishment realization attainment execution implementation enactment operation exercise practice application utilization employment exploitation adoption deployment insertion introduction presentation demonstration exhibition display show reveal exhibit expose uncover unveil disclose divulge impart communicate convey transmit transfer relay pass hand give share distribute allocate assign allot apportion portion ration dispense supply provide furnish equip outfit arm tool instrument apparatus device gadget contraption mechanism machine engine motor generator turbine pump compressor blower fan heater cooler radiator boiler furnace stove oven range grill barbecue smoker fireplace chimney flue duct vent pipe tube hose wire cable cord rope string line thread filament strand fiber optic laser beam ray wave light sound noise music voice speech language dialect accent intonation inflection tone pitch volume loudness softness quietness silence calm peace tranquility serenity stillness hush murmur whisper sigh breath breeze wind gust draft blast storm hurricane cyclone tornado typhoon monsoon rain shower drizzle sprinkle mist fog cloud haze smog smoke dust dirt soil mud clay sand gravel pebble stone rock boulder mountain hill slope incline gradient ascent descent rise fall drop plunge dive leap jump spring bound hop skip trot gallop canter pace stride march walk step stroll saunter amble meander wander roam ramble trek hike climb scramble crawl creep sneak slide glide slip skid skidder sledge sleigh sled skate ski snowboard surf sail row paddle canoe kayak raft float swim wade bathe soak dip dunk immerse submerge sink drown wash rinse cleanse purify sterilize sanitize disinfect decontaminate detoxify neutralize counteract offset negate cancel annul invalidate nullify void abolish repeal rescind revoke retract withdraw retreat retire resign abdicate renounce relinquish surrender yield submit capitulate concede cede grant allow permit authorize license empower enable entitle qualify justify excuse forgive pardon absolve acquit exonerate vindicate exempt exclude omit overlook ignore disregard neglect avoid shun evade escape elude dodge sidestep circumvent bypass skirt navigate steer maneuver pilot guide direct lead conduct drive ride fly soar hover levitate ascend descend elevate lower raise lift hoist haul tow pull drag draw tug yank jerk hitch hitchike thumb flag signal beckon wave gesture nod bow curtsy salute greet welcome acknowledge recognize identify name label tag brand mark stamp seal imprint etch engrave carve inscribe chisel sculpt mold cast forge hammer pound beat strike hit punch kick slap smack whack bash crash bang boom thud clatter clang clink click tick tap pat clap snap crack pop fizz sizzle hiss buzz hum drone rumble roar thunder clap peal toll ring jingle tinkle chime ding dong bell gong knell alarm alert siren horn whistle shout yell scream holler howl screech squeal squawk squall shriek cry weep sob wail moan groan grunt growl snarl bark bay yelp yap whimper whine bleat bray neigh snort snuffle sniff sneeze cough hack hawk spit expectorate vomit retch gag choke gasp pant puff huff blow wheeze rasp croak chirrup trill warble twitter tweet sing chant hymn carol serenade lullaby ballad aria opera musical symphony concerto sonata suite overture prelude fugue canon round madrigal motet cantata anthem psalm hymn gospel spiritual blues jazz ragtime swing bebop cool funk soul disco rap hip hop reggae ska calypso salsa samba tango flamenco bolero paso doble cha cha mambo merengue rumba bachata zouk lambada kizomba cumbia vallenato ranchera mariachi banda tejano corrido polka mazurka waltz minuet gavotte bourree sarabande allemande courante gigue jig reel hornpipe strathspey fling sword dance highland fling ceilidh kilt tartan plaid sporran dirk sgian dubhskeandubh skeandhu skeandu sneandu skeneandoo knife blade edge point tip spear lance pike halberd glaive guisarme bill hook scythe sickle machete bolo parang kukri khukuri gurkha dao katana wakizashi tanto naginata yari bo staff baton stick rod pole shaft handle grip knob pommel guard hilt crossguard quillon ricasso fuller groove blood channel fuller groove fuller groove fuller groove fuller groove fuller groove fullers grooves fullering fullered fullyers fulled folds folding folded foldings foldeds foldups folduppie folduppies knockout knockouts knockdown knockedown knockedowns knockoff knockoffs copy copies mimic mimics imitation imitations clone clones replica replicas reproduction reproductions duplicate duplicates facsimile facsimiles counterfeit counterfeits forgery forgeries fake fakes sham shams phony phonies bogus boguses fraudulent frauds deceit deception trickery cheating swindle scam con racket hustle grift fleece bilking defraud mislead misinform deceive dupe hoodwink bamboozle fool gull beguile charm enchant captivate enthrall mesmerize hypnotize spellbind fascinate intrigue engage engross involve absorb immerse occupy preoccupy monopolize dominate command control rule govern manage administer supervise oversee direct coordinate organize arrange orchestrate choreograph engineer architect mastermind plan scheme strategize devise formulate contrive concoct invent create originate initiate inaugurate launch begin start commence embark undertake assume take over seize capture conquer vanquish defeat overthrow topple depose dethrone displace supplant usurp replace succeed follow inherit occupy hold possess retain maintain sustain preserve uphold support defend protect safeguard shield shelter harbor harbour refuge sanctuary asylum haven escaperescuerescuessaverescuesrescueoperationsavingoperationreliefrescueaidhelpassistancecomfortconsolationsuccorreassurancereprievesupportbackingupliftingencouragementboostmoraleconfidencehopefaithtrustbeliefreverencevenerationadorationworshipdevotiondedicationcommitmentsacrificeloyaltyfidelityallegianceobediencecomplianceadherencedevoutnesssanctityholinesspuritysacrednesstranscendencedivinityspiritualityreligiousnesstheologydoctrinecreeddogmabeliefsfaithshopefulfillmentrealizationsuccessachievementattainmentaccomplishmentcompletionfinaleendingclosureconclusionresolutiondenouementsatisfactioncontentmentjoydelightpleasureblissraptureecstasyfelicitybeatitudejubilationtriumphprestigegloryhonorrenownfamecelebritynoteworthydistinguishedeminentprominentillustriousdistinctioneminenceprestigiousreputableesteemedrespectablehonorablecreditablecommendableremarkablerecognizableidentifiablememorableunforgettablelegendarymythicaliconicclassicexemplarymodelidealparagonprototypearchetypebenchmarkstandardcriteriaguidelineyardstickmeasuringrodgaugeindicatorreferencepointtouchstonecornerstonestonefoundationbasegroundworkbasiscoreprinciplessourcespringwellheadoriginrootstembranchlimbboughtwigleafshootsproutgrowthdevelopmentexpansionextensionaugmentationincreaseadditionincrementenhancementimprovementadvancementprogressionforwardmovementupwardtrendrisingclimbingascendingmountingelevatingupliftingraisinghoistingliftingcarryingbearingtransportingmovingtransferringrelocatingshiftingswitchingchangingalteringmodifyingtransformingtransitioningevolvingdevelopingenlargingincreasingmultiplyingdoublingtriplingquadruplingquintuplingsixfoldseventoldoctupledninetimesdecapletimeshundredfoldthousandtimesmilliontimesbilliontimestrilliontimesquadrilliontimessoaringtoweringskyrocketingzoomingleapingjumpingsprintingrunningrushingdartingspeedingturboboostedfasteracceleratedquickenedspedhurriedrapidfastswiftfleetlightningboltwhirlwindcyclonegalesuperstormhyperdrivewarpdrivelightspeedhyperspacequantummechanicsnuclearfusionatomicenergycosmicforcespacepowergravityblackholewormholesingularitiesparalleluniversesmultiversetheoriesdimensionspossibilitiesspeculationshypothesesresearchstudystudiesinvestigationsanalysesexperimentsobservationsdatacollectionfieldworklaboratorytestscontrolledconditionsvariablesconstantsparametersmetricsbenchmarksstandardscriteriarequirementsgoalsobjectivesaimstargetspurposemissionvisionstrategyplanblueprintroadmapguidelinesprotocolsinstructionsmanualhandbookguidebookencyclopediaatlasdictionarylexiconcompendiumcatalogdirectoryindexregisterlistinventoryrosterschedulecalendarprogramagendaitinineraryplannerorganizerchartdiagramgraphflowchartschematiclayoutdesignarchitectureengineeringconstructionbuildingprojectmanagementadministrativeoversightcoordinationcontrolsupervisionmonitoringauditingreviewingevaluatingappraisalanalyzingdiagnosingprescribingrecommendingssuggestedadvisoryconsultativeservicingmaintainingrepairservicingfixrectifysolutionremedycorrectionadjustmentregulationcalibrationfine-tuningoptimizingmaximizingrefiningpolishingperfectingenablingfacilitatingempoweringauthorizinglicensingcertifyingvalidatingverifyingendorsinganointinganointenanointedordainedappointedcommissioneddeputizeddelegatedauthorizedlicensedpermittedallowedacceptedreceivedwelcomedembracedapprovedacknowledgedrecognizedidentifiednamedlabelledtaggedmarkedstampedsealedengravedetchedinscribedpainteddrawnsketchedillustrateddepictedportrayedrepresentedexpressedmanifestedenumerateditemizedlistedcataloguedregistereddocumentedrecordedfileddraftedwrittencompiledassembledcollectedaggregatesummarisedcondensedabridgedshortenedcompressedcompactedsqueezedtightpackedcrammedstuffedsaturatedfilledloadedbulgingoverflowingovertoppingoverwhelmedswampedfloodeddrownedsubmergedimmersedinundatetotallycompletelyutterlytirelesslyceaselesslygenuinelyauthenticallytruthfullyreallyactuallyfactuallyliterallyplainlysincerelyearnestlywholeheartedlyphilosophicallyintellectuallyemotionallypsychologicallyphysiologicallybiologicallychemicallyphysicallymaterialisticallyscientificallytechnologicallymechanisticallysystematicallymethodicallyprocedurallyformulativenormativelylogarithmicallymathematicallynumericallyarithmetichyperbolictangentcotangentsinescaledcosineangledegreecurvelinearfunctionequationalgebraicgeometriccalculustrigonometryprobabilitystatisticsanalysisdataresearchstudyexperimentobservationmeasurementvariableconstantparameterfactorconditioncircumstancecontextbackgroundenvironmentsettinglocationpositionplacementarrangementorientationalignmentconfigurationstructureframeworkscaffoldmodeltemplatepatternexampleinstancecaseoccurencesituationeventincidentexperienceepisodephenomenonscenariosequencechainreactioncausalityeffectramificationimplicationconsequenceimpactresultoutcomeproductbyproductoutputyieldharvestreturnprofitgainbenefitadvanatgebonusdividendrewardawardprizetribtugiftsouvenirtokenmomentomemorykeepsakecollectibleantiquecurioartifacttreasuregemjewelornamentdecorationembellishmentaccessoryappendageattachmentadd-onplug-inmodulecomponentunitpartpieceelementintegralintegratorintegrativeintegratableincorporatableabsorbablesaturatablepenetrablepermeablesoftwarerunningoperatingsystemcomputersoftwarehardwaretoolsinstrumentsequipmentgearutensilsapparatusdevicesmachinerymachinesenginecomponentspartsunitsmodulespieceselementssectionssegmentslayerslevelsstrataphasesstepsstageseventsactsplaysperformancesdemonstrationspresentationsdisplaysshowsexhibitionsspectaclespageantsceremonialritualsobservancesfestivitiescelebrationscommemorationsanniversariesmilestonescentennialsbicentennialstercentennialsquadricentennialsquinquecentenialssexagen