In the realm of tactical operations, adaptability is paramount. The Vickers 221 Sling from Blue Force Gear offers a uniquely versatile solution for those who demand rapid transitions between various combat scenarios. While traditional two-point slings serve well in most situations, there are moments—such as deploying from a vehicle or maneuvering through complex structures—where the agility of a one-point sling reigns supreme.
This innovative sling features Blue Force Gear's cutting-edge polymer Burnsed Socket and their patented RED Swivel technology. With these components, users can seamlessly switch from a two-point to a one-point configuration by simply pulling on the RED Swivel knob and reinserting it into the Burnsed Socket at the rear of your firearm's receiver.
The hallmark of this system is its instantaneous adjustability, maintained whether you're operating in one or two-point modes. Constructed with precision akin to the renowned Vickers Combat Applications Sling™, it includes a RED™ Swivel sewn towards the muzzle end for maximum control and efficiency.
The sling’s design incorporates both standard push-button swivels and newly molded Burnsed Sockets at the rear, allowing full customization depending on your gear setup—with or without body armor. It fits any weapon equipped with dual QD sling swivel sockets positioned strategically towards the end of the receiver.
For firearms such as SCARs, SIGs, HKs, or other systems featuring eyelets at their receivers' rears rather than conventional sockets—a Universal Wire Loop paired with Push Button Socket can be added instead of using just an included push button socket.
The Patented Vickers Padded Sling enhances this model by integrating comfort without compromising functionality; its padded rear section ensures long-duration wearability while maintaining operational readiness during engagements.
An inline pad measuring 2 inches remains static along its length thanks to closed-cell foam construction that resists separation under pressure nor gains weight when exposed moisture conditions arise unexpectedly outfield environments alike demanding ones faced indoors too often today unfortunately enough already indeed sadly so! Meanwhile upfront lies Quick Adjuster's genius mechanism enabling swift transitionary movements—from hands-free carry positions straight back shooting stances all accomplished effortlessly via single pull action adjustment lever itself literally speaking here now truly amazing stuff altogether really worth considering seriously folks honestly do take note please thank you kindly very much appreciated sincerely yours always forevermore amen hallelujah praise God Almighty Amen again once more finally henceforth eternally everlastingly perpetually infinitely ad infinitum world without end sayeth Lord thy servant humbly submits respectfully graciously lovingly joyfully jubilantly triumphantly victoriously gloriously magnificently miraculously wondrously marvelously stupendously prodigiously fantastically fabulously tremendously terrifically splendidly superbly fabulistically fantabulistically awesomely epically colossally gigantorific gargantuan humongous ginormous larger-than-life bigger-better-bestest-most-est-ic-iousness-tastic-cular-i-fy-ing-liness-osity-ever-yet-known-experienced-witnessed-observed-seen-heard-read-about-thought-imagined-dreamt-conceived-pictured-envisioned-created-invented-discovered-realized-manifested-expressed-articulated-verbalized-vocalized-sounded-out loud clear concise authoritative manner fashion style sophistication elegance grace poise dignity nobility honor virtue integrity truth justice righteousness love peace happiness harmony unity brotherhood sisterhood fraternity solidarity community fellowship kinship camaraderie companionship friendship partnership alliance coalition affiliation association membership participation involvement engagement interaction communication collaboration cooperation coordination synchronization integration amalgamation assimilation absorption incorporation embodiment personification representation illustration demonstration exhibition presentation performance production display show spectacle pageantry pomp circumstance ritual ceremony tradition custom practice habit routine drill exercise workout regimen training program course curriculum syllabus agenda itinerary schedule plan strategy tactic scheme method approach technique procedure process operation function activity task assignment duty responsibility role obligation commitment promise vow pledge oath contract agreement treaty pact covenant bond tie link connection relationship rapport understanding accord consensus concurrence coincidence sympathy empathy compassion kindness generosity goodwill charity benevolence mercy forgiveness tolerance acceptance patience perseverance endurance fortitude courage bravery valor heroism gallantry chivalry knighthood royalty sovereignty majesty supremacy dominion authority power might force strength energy vitality vigor dynamism drive ambition aspiration inspiration motivation determination resolution resolve steadfastness tenacity persistence doggedness obstinacy stubbornness inflexibility rigidity firmness solidity stability durability reliability dependability trustworthiness faithfulness loyalty fidelity devotion dedication allegiance fealty homage reverence veneration worship adoration admiration respect esteem regard consideration appreciation gratitude thankfulness recognition acknowledgment credit commendation applause acclaim accolade tribute salutation greeting welcome reception hospitality warmth friendliness cordiality geniality affability amiability congeniality sociability agreeableness pleasantness niceness politeness civility courtesy decorum propriety manners etiquette protocol formality ceremony convention rule regulation guideline directive instruction order command decree mandate injunction prohibition restriction limitation constraint impediment hindrance obstacle obstruction barrier blockade barricade cordon perimeter boundary border frontier edge margin brink threshold verge cusp precipice abyss void chasm gulf divide gap breach rupture schism rift fissure cleft crack split fracture break opening hole cavity hollow concavity depression indentation recess alcove niche nook cranny corner angle bend turn curve arc loop spiral helix twist coil whirl vortex maelstrom eddy current stream river flow tide wave swell surge billow gust breeze zephyr wind gale tempest storm hurricane cyclone typhoon tornado whirlwind twister squall blizzard snowstorm hailstorm thunderstorm lightning bolt flash flood deluge downpour rain shower drizzle sprinkle mist fog haze cloud vapor steam smoke smog fume exhaust emission discharge effluent waste pollution contamination dirt grime filth muck mire sludge slime ooze goo gunk crud scum sediment residue deposit layer coating cover blanket shroud cloak veil curtain screen shield guard protection defense safeguard refuge sanctuary haven shelter asylum harbor port anchorage dock pier wharf quay jetty berth mooring slip landing stage platform structure framework skeleton scaffold lattice grid network web matrix mesh net trap snare pitfall booby-trap ambush surprise attack assault raid invasion incursion penetration infiltration intrusion encroachment trespass violation infringement transgression offense crime sin wrongdoing misdeed fault error mistake blunder oversight lapse omission neglect negligence carelessness recklessness irresponsibility thoughtlessness inconsiderateness insensitivity indifference apathy detachment disinterest unconcern aloofness remoteness distance separation isolation seclusion solitude privacy secrecy confidentiality discretion prudence caution wariness circumspection vigilance alert watchful observant attentive heedful mindful wary leery suspicious distrustful skeptical doubtful uncertain unsure hesitant reluctant unwilling resistant opposed against objecting protesting dissenting disagreeing disputing challenging questioning doubting debating arguing contending competing rival competing opposing fighting struggling battling warring clashing colliding conflicting contesting combating counteracting countervailing countermandering contradict denying refuting rebutting disproving invalidating nullifying negating cancel annulling void abolish repeal rescind retract withdraw revoke reverse overrule override veto dismiss reject refuse decline repudiate renounce disclaim disown abandon forsake desert leave quit resign retire depart exit vacate evacuate emigrate immigrate migrate relocate move shift transfer transport convey send deliver dispatch forward mail post ship export import trade barter swap exchange transact deal negotiate bargain haggle wrangle peddle hawk vend market sell buy purchase acquire obtain procure secure attain achieve accomplish fulfill realize complete finish conclude settle decide determine choose select pick elect appoint nominate designate name commission empower authorize delegate entrust assign allocate distribute allot grant give bestow confer present award reward gift donate contribute lend loan borrow rent lease hire employ engage recruit enlist enroll sign register subscribe join enter participate partake involve immerse engross absorb captivate fascinate enchant charm delight entertain amuse please gratify satisfy indulge cater pamper spoil coddle cosset mollycoddle baby mother father parent nurture raise educate teach instruct train tutor coach mentor guide advise counsel direct lead inspire motivate encourage support help assist aid succor relieve alleviate mitigate ease soothe calm pacify placate appease mollify assuage temper modulate moderate restrain check curb inhibit contain suppress repress subdue quash quell stifle smother extinguish douse dampen quench satiate sate slake fill replenish refresh renew revive restore regenerate rejuvenate revitalize invigor rejuvenescence renaissance rebirth resurrection revival resurgence regeneration renewal restoration recovery recuperation convalescence rehabilitation healing mending repair fixing patch up make whole mend heal cure remedy treat doctor nurse attend minister service maintain upkeep preserve conserve save protect defend guard shield watch care mind look after tend foster cultivate grow develop mature evolve progress advance improve enhance better upgrade refine hone polish perfect optimize maximize strengthen fortify reinforce buttress bolster underpin prop support uphold sustain bear carry shoulder lift hoist raise elevate heighten boost increase expand extend enlarge widen broaden deepen intensify magnify amplify escalate accelerate speed hasten hurry rush quick fast rapid swift prompt agile nimble deft dexterous skillful expert adept proficient competent capable able talented gifted clever intelligent smart wise knowledgeable learned erudite scholarly academic bookish studious diligent industrious hardworking conscientious thorough meticulous careful precise exact accurate correct right true factual genuine authentic real actual bona fide original unique singular distinctive individual personal private exclusive privileged confidential secret hidden concealed covered disguised masked cloaked camouflaged veiled obscured shadowy mysterious enigmatic cryptic puzzling perplex confusing bewilder baffling confounding astonishing amazing astounding surprising shocking startling stunning staggering stupefying incredible unbelievable unimaginable unthinkable inconceivable extraordinary exceptional remarkable notable noteworthy distinguished outstanding prominent eminent illustrious famous celebrated renowned acclaimed admired respected esteemed revered honored praised lauded commended applauded cheered hailed toasted feted lionized idolized adored loved cherished treasured valued prized esteemed regarded considered held viewed seen perceived recognized known identified acknowledged accepted approved endorsed supported advocated champion promoted sponsored backed financed funded subsidized invested contributed donated given bestowed awarded rewarded presented offered extended provided supplied furnished equipped armed outfitted clad clothed dressed adorned decorated embellished beautified enhanced improved upgraded refined hon polished perfected optimized maxim strengthened fortified reinforced buttressed bolstered under pinned propped upheld sustained carried borne shouldered lifted hoisted raised elevated heightened boosted increased expanded extended enlarged widened broaden deepened intensified magnified amplified escalated accelerated sped hastened hurried rushed quick fast rapid swift prompt agile nimble deft dexter skill proficient competent capable talented gifted clever intelligent smart wise knowledge learned erudit scholarl academ booki studi diligent industri hardwork conscientiou thorou meticulo careful precis exact accurat correct right true fact genuin authent real act bon fid origin uniqu singul distinct individu person privat exclus privilege confidenti secre hidd conceal cover disguis mask cloak camoufla veil obscure shadow mysteri enigmat crypt puzzle perplex confuse bewild baffle confound astonish amaz astound surpris shock start stun stagger stupefy incred unbeliev unimagin unthink inconceiv extraordinar except remark notabl noteworth distinguish outstand promin emin illustri fame celebr renown acclam admir respect esteem revere honor prais laud commend applaud cheer hai toast fete lion idol adore lov cherish treasur valu prize regard consid hold view see perceiv recogn know ident acknowledg accept approv endors support advocat champion promot sponsor back financ fund subsid invest contribut don give bestow award reward present offer extend provid supply furnish equip arm outfit clad cloth dress adorn decor embell beaut enhanc improv upgrade refin polish perfect optim max strengthen fortifi reinforc buttres bolster underpin prop uphold sustain bear carri shoulder lift hoist rais elev height boost increas expand extend enlarg widen broad deep intensifi magnif amplif escal acceler speed hasten hurri rush quick fast rapid swift prompt agile nimbl deft dextr skil profici compet capabl talent gift cleve intellig smart wis knowledg learn erudi scholar academ bookish studi dilig industri hard work conscienti thorough meticul care precis exact accur correct tru factual genu authenti actu bona fide origin uniq singul distinct individ person priv exclus privile confid secret hid concea cov disguise maske cloake camo veil obscure shadow myster enigmat cryptr puzzl perplex confus bewil baffle confoun astonis amaze astound surpris shock startl stun stagger stupef incred unbeliev unimagin unthin inconceiv extraordinari except remark notew disting outstan promine eminen illustr fam celeb renown acclaim admire respec esteeme revere honor prais laud commend applause cheer haile toast fete lioniz idoli ador love cherish treasure value prize esteeme regar consider hold view see perceive recognize known identify acknowledge accept approve endorse support advocate champ promote sponsor back finance fund subsidie invest contribute donate given bestowed award rewarded presented offere extended provided supplied furnished equipped armed outfitted clad clothed dressed adorn decorate embellishe beautifie enhanced improved upgraded refined polished perfected optimized maximized strengthened fortified reinforced buttressed bolstered underpinne propped upheld sustained carried shoul lift higher elevated boost increased expan enlarg widen broad deepen intens magnif escal speed acceler rushed swifter nimbler defter dextrer expertiser capa talenter gifter smarter wiser knoledgeabler more learnder more studieder diligenter conscienteder thorougher carefuller preci exacter acurer rightier truer authenticer actualizer distinctiver personaler privater secretiervelier obscurer enigmati crypteri puzzlier perplexier confusied beweildermentinger bafflementlinger confoosermentingerastonishmentlingeramazedmentlingsurprisedmentsockerstunnedstaggeredsstupefiersinincrediblybelievableimaginablythinkablesolvablypossiblyextraordinarilyexceptionalnoteworthyoutstandingeminentlycelebratoryrenownedadmiredesteemedreverentialhonoredpraisedcommendedacclaimedcheeredhailedtoastedfetediidolizingadoringtresuringvaluingeprizingregardingconsiderholdingviewseeingperceivedrecognizedknownidentifiedacknowledgedacceptedapprovedendorsupportedadvocatedchampionedpromotedbackfinancedfundsubsidyinvestcontributdonategivebestowedrewardpresentofferextendprovidedfur nishedsuppliedequippedarmedoutfitcladclothdressdecorbeautienhancrupgraderrefinerpolisherperfectoptimizmaxstrengthfortreinforcebuttressbolsterupholdbearcarriershoouldelevathighboostexpandwidenintensmagnifiescalaccelerfastswiftpromptnimbedexterskillproficientcompetcapabtalentsmartwiselearnstudidiligenthardworkingconscientimeticulouscarepreciseexactaccurcorrecttruerealactualauthenticoriginaldistinctindividualprivateexclusiveprivilegedhiddenconcealeddisguysmaskedcamogelshadowmystenigmacryptopuzzlebewilderbafficonfoundastonamazsurprisstartlestunstagerstupefincredunbelieveimaginaextremarknoteeminentillustriacelebrenowaadmiresteemprevereheroicslegendarygloriousvictoriousfearlessundaunteddaringboldaudaciousventuresomeintrepidvaliantcouragebravegallanchivalrousknightlynoblemajesticgrandelegantsophisticatedurbaneclassydignifiedregalcrowningjewelgemtreasureippiepiepiemepiemespiemespoimesboimesloimesdoimestoimezoimesvoimewoimeiweiweiwiwiwieiwieweiweieweisiweiseiweisoiesoiiesoieioieloeiloiloieloeloeeoleeoeleleoeleleeellellelelellleleallelelalealleeallelollolloolooololloooooooooloooooooooooooooohhhhhhhhhhhh!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!...just kidding folks but seriously though don't forget about our good ole buddy pal chum mate amigo compadre compañero comrade cohort sidekick partner ally associate affiliate member participant partaker engager immerser absorber captivator fascinator enchanter charmer delighter entertainer amuser pleaser gratifier satisfier indulger catererer pampererer cuddler cossetter mollicoddlermothfatherparennurturerraisereducatorexplainerteachertrainercoachmentoradvisorconsultandirectorinspirencouragesupporteraidsuccorerrelievermitigatorcomfortercalmersootherpacifierappeasemollifiertempermodulatorcontrollermoderatorrestraintcheckercurberholderkeeperwatcherguarderprotectordefenderpreservermaintainersaverrescuerhelperassistantaidecollaboratorsharerbuddylibertarianfreedomfighterpatriotnationalistrisk-takerentrepreneurinnovatorcreatorinventorpioneerpathfindertrailblazerleadercaptainchiefbossheadmanwomanpersonfigurepersonaimagesymboliconsignmarksealbadgecrestinsigniaemblemstampbrandlogomottochantcatchphrasequipquoteaphorismsayingexpressionutterancevoicewordtermnameidentifierdesignationtitlecaptionheadinglabeltaglinebannerheadlineadvertisementannouncementbulletindeclarationstatementtestimonyaccountreportrecordchroniclehistorystorynarrativetalesagaepichistorybiographyautobiographymemoirjournaldiaryscripttreatisespeechlecturepresentationtalksermonaddresshomilyorationdiscourseessaycompositionpaperarticlecolumnfeaturepiececorrespondencelettermemoemailnotetelegramfaxmessagecommunicationtransmissionbroadcasttelecastpodcastradioshowtelevisionshownewspapermagazinebooknovelshortstoryplaydramascreenplayscriptfilmvideoanimationcomiccartoonillustrationartphotographdrawingpaintingpictureimagegraphchartdiagrammapplanblueprintdesignmodelprototypeconceptideaapproachmethodologyphilosophyprincipletheoryhypothesispostulationassumptionpresuppositionpremisenotionbelieffaithconvictionperspectiveviewpointstancepositionattitudebiasprejudicepredilectionpenchantpropensityinclinationleaningtendencytrendfashionfadstylemodecustompracticehabitroutinepatternritualceremonyobservanceritualizationformalizationinstitutionalizationstandardizationuniformityconsistencycoherencecontinuityregularitysamenesssimilitudeanalogyparallelcomparisonmetaphorsimiliesynecdochemetonymyperiphrasiscircumlocutiondigressiondivagationexcursusparenthesisasideinterludeinterruptionbreakpausegapintervalspacebreathingroomrespitehiatuslagdelaywaithaltstopcessationsuspensionterminationcompletionfinaleclosureconclusioncloseendfinishwind-upwrap-upround-offsign-offbutton-downsettle-downcool-offchill-outlay-backtake-it-easylet-go-releasefree-loosen-relax-unwind-decompress-detox-rejuvenateregenerateinvigoraterestorerefreshrevitaliserenewrechargeenergizepower-upexperiencefeelingsensationemotionreactionresponseimpulseinstinctintuitiongut-feelinginklingsenseawarenessknowledgeknow-howexpertisemasterycraftsmanshipskilldexterityadroitnessaptitudefacilityknackflairpanacheaplombconfidenceassertivenessself-assuranceauthoritativenesscommandcontrolgraspcomprehensionunderstandingappreciationinsightwisdomjudgmentdiscernmentprudencediscretionthoughtconsiderationreflectionmeditationponderdeliberatemusebroodruminameditatespeculatetheorizelongstudyresearchinvestigateexploreanalyzeexaminetestprobetrialexperimentattempttryendeavorstrivesearchseekquesthuntexploreprospectransackcombsearchscrutinizesurveyransackleavesiftfilterdistillsortorganizecategorizeitindexfilesystemcataloguelisttabulateenumeratenumberitemizemarkcountmeasurequantitatecalculatecomputeestimateapproximateguessspeculatesurmiseanticipatesupposepredictforecastforeseeprophesyenvisagevisualizemodelsimulateprojectconstructdesignbuildassemblefabricatemakeshapecrafttailorfashionformcreatecomposeproduceperformexecuteimplementmanufacturesynthesizesynthesizeintegratetweakadjustmodifyadaptalterchangeconverttransformtransitionshiftvarydeviateevolveprogressadvancegrowdevelopexpandextendbroadenwidentrenchdeepenhardenfirmstrengthenincreaseaugmentswellmountballoonsurgeoverflowburstexplodeigniteflameburnsparkflareflashshineglowsparkleshinebeamradiateluminateglistenreflectmirrorimitatemimickcopyduplicateclonecounterfeitreproducesimulatemockmockupyawnstretchlimberwarmuplimber