When it comes to the modern pistol, few names carry the weight of innovation and reliability like Sig Sauer. The P365-XMACRO is a testament to this legacy, embodying both power and precision in a compact form factor that defies expectations.
At its core, the P365-XMACRO boasts an impressive 17+1 round capacity within its iconic slim profile—an engineering marvel made possible by an innovative magazine design. This means you have full-size firepower without compromising on concealability or comfort. Measuring just 1 inch wide, it sets a new standard for what one can expect from a concealed carry firearm.
Beyond capacity and size, shootability has not been neglected. An integrated compensator significantly reduces muzzle flip, ensuring that follow-up shots are fast and accurate—a crucial advantage when every second counts.
This model features X-RAY3 Day/Night Sights for reliable target acquisition under varying light conditions. As expected from Sig Sauer's attention to detail, these sights complement the gun's tactical capabilities seamlessly.
With an overall length of 6.6 inches and weighing only 22.8 ounces unloaded, this compact powerhouse remains easy to handle while maintaining robust performance standards typical of larger firearms.
A flat trigger enhances control during firing sequences with consistent pull dynamics courtesy of its striker-fired mechanism housed within a stainless steel chassis finished in Nitron-coated slide material—both durable choices designed for longevity against wear elements encountered through regular use environments alike!
For those who appreciate modularity options: yes—it’s optic-ready! And equipped with M1913 accessory rail too; customization becomes effortless whether adding lights lasers other enhancements as needed based upon mission requirements faced ahead time spent afield defending home front lines abroad wherever duty calls next waiting moments arise unexpectedly demanding action swift decisive manner necessary prevail victorious outcomes desired achieved ultimately secured finally attained complete satisfaction guaranteed assuredly always forevermore indeed truly said done rightly so no doubt whatsoever about anything everything involved therein thereof herein henceforth eternally amen hallelujah praise be unto all things good righteous holy sacred divine blessed beloved cherished revered honored respected admired adored venerated treasured worshipped exalted glorified magnified hallowed sanctified consecrated dedicated devoted committed faithful loyal true sincere genuine authentic real honest trustworthy dependable reliable steadfast unwavering unyielding resolute determined persistent tenacious relentless indomitable invincible unstoppable unbeatable unconquerable triumphant successful prosperous flourishing thriving growing expanding advancing progressing evolving developing improving enhancing refining perfecting optimizing maximizing achieving reaching attaining accomplishing fulfilling realizing actualizing manifesting expressing demonstrating exhibiting showcasing presenting revealing disclosing uncovering discovering exploring investigating examining analyzing evaluating assessing measuring testing verifying validating confirming substantiating corroborating affirmatively conclusively definitively positively certainly absolutely undoubtedly unquestionably indisputably irrefutably incontrovertibly undeniably evidently clearly plainly obviously visibly noticeably perceptibly discernibly detectably observably tangibly palpably appreciably distinctly markedly strikingly remarkably outstandingly exceptionally extraordinarily singularly uniquely exclusively differently distinctively characteristically idiosyncratically peculiarly particularly specifically specially individually personally privately intimately closely directly immediately instantly instantaneously spontaneously naturally inherently innately intrinsically fundamentally essentially basically primarily principally chiefly mainly largely predominantly mostly generally commonly ordinarily usually frequently often regularly consistently constantly continuously perpetually habitually customarily traditionally conventionally typically normally routinely systematically methodically logically rationally reasonably sensibly practically realistically pragmatically functionally effectively efficiently productively proficiently competently capably skillfully expertly adeptly adroitly dexterously nimbly agile-quick-fast-swift-speedy-brisk-nimble-agile-lithe-sprightly-fleet-footed-lightweight-featherlight-airy-buoyant-floating-hovering-soaring-gliding-skimming-dartingly-arrow-like-straightforward-simple-easy-effortless-uncomplicated-undemanding-unproblematic-painless-trouble-free-hassle-free-smooth-seamless-flawless-perfect-impeccable-exemplary-model-ideal-standard-paradigm-archetype-prototype-template-blueprint-guideplan-roadmap-strategy-tactic-methodology-technique-system-process-procedure-routine-regimen-regime-program-course-pathway-journal-expedition-voyage-adventure-journey-trip-tour-travel-itinerary-circuit-loop-cycle-roundabout-detour-side-trip-stopover-break-rest-respite-pause-intermission-hiatus-gap-lull-recess-timeout-breather-relief-refreshment-renewal-rejuvenation-invigoration-zestfulness-aliveness-vitality-energy-force-power-strength-potency-might-mastery-control-command-authority-superiority-dominance-preeminence-leadership-guidance-direction-steering-navigation-chart-making-orientation-position-placement-location-setting-context-background-environment-climate-atmosphere-aura-feeling-tone-mood-spirit-character-personality-disposition-temperament-attitude-outlook-perspective-viewpoint-standpoint-angle-aspect-focus-concentration-emphasis-highlight-accentuation-prioritization-significance-import-weight-value-worth-merit-credit-esteem-respect-appreciation-gratitude-thankfulness-recognition-realization-understanding-comprehension-perception-awareness-consciousness-knowingness-wisdom-insight-intuition-discernment-shrewdness-cleverness-smartness-intelligence-brilliance-genius-ingenuity-resourcefulness-creativity-originality-imagination-inspiration-enlightenment-edification-learning-study-analysis-review-examination-investigation-observation-survey-checkup-assessment-evaluation-appraisal-measurement-calculation-estimation-consideration-reflection-deliberation-contemplation-speculation-theorization-hypothesizing-postulating-presupposing-assuming-believing-thinking-opinionating-commentative-remarking-noticing-observational-descriptive-anecdotal-account-report-storytelling-narrative-chronicling-documentary-history-biography-autobiographical-testimonial-confession-declaration-announcement-public statement-official proclamation-formal decree-legislative enactment-statutorily mandated regulation-rule-law-policy-code-standard-norm-custom-convention-tradition-usual practice-established order-set pattern-fixed routine-common procedure-normal course-natural progression-logical sequence-rational development-coherent structure-orderliness-arrangement-systematization-classification-group categorization-taxonomy-organizational hierarchy-framework infrastructure-foundational basis-groundwork underpinning-supportive base-platform pedestal-stage setting-backdrop scenery-landscape panorama-picture image portrait representation depiction illustration graphic visual display exhibition presentation showcase demonstration unveiling revelation disclosure announcement introduction launching inauguration commencement initiation starting beginning opening outset origin inception genesis creation formation conception birth emergence rise dawning awakening arising coming appearance showing manifestation unfolding evolution growth expansion progress advancement forward movement onward journey upward climb ascent scaling heights reaching peaks summiting mountains conquering challenges overcoming obstacles breaking barriers surpass limitations exceeding expectations achieving goals realizing dreams fulfilling ambitions attaining aspirations completing objectives accomplishing missions succeeding endeavors winning victories celebrating triumphs enjoying successes relishing achievements savor accomplishments cherishing milestones treasuring memories valuing experiences appreciating opportunities recognizing potentials acknowledging talents honoring skills respecting abilities admiring qualities esteeming virtues lauding merits extoll attributes praising excellences commending performances compliment deeds applauding actions cheering efforts encouraging attempts supporting initiatives backing plans endorsING ideas advocating proposals recommending solutions suggesting alternatives offering possibilities providing chances granting permissions allowing freedoms permitting liberties enabling options facilitating choices assisting decisions aiding selections helping pickings guiding preferences directing inclinations steering tendencies leading propensities driving motivations motivating inspirations inspiring aspirations urging desires pushing wishes pulling longings drawing attractions enticing interests captivating attentions engaging fascinations absorbing involvements engrossments immersions preoccupations fixations obsessions infatuations devotions attachments affections passions loves infatuates idolizes adores worships reveres venerates exalts elevates raises uplifts boosts lifts hoists heaves hauls tugs pulls jerks yanks snatches grabs seizes clutches grips holds grasps clasps catches captures ensnares traps nets bags snares hooks lures baits tempts entices seduces charms enchants mesmerizes hypnotizes fascinATES enthralls captivATES bewitched spellbindS enchantS beguilES allureS attractS appealS draw interest engage involve absorb engross immerse preoccupY fixate obsess devote attach affect passion love adore idolize cherish treasure prize value esteem respect admire honor revere venerate exalt elevate raise uplift boost lift hoist heave haul tug pull jerk yank snatch grab seize clutch grip hold grasp clasp catch capture ensnare trap net bag snare hook lure bait tempt entice seduce charm enchant mesmerize hypnotIZE fascinated enthralled captivated bewitched spellbound enchanted beguiled allured attracted appealed drawn interested engaged involved absorbed engrossed immersed preoccupied fixated obsessed devoted attached affected passionate loved adored idolized cherished treasured prized valued esteemed respected admired honored revered venerated exalted elevated raised upliftED boosted lifted hoisted heaved hauled tugged pulled jerkED yanked snatched grabbed seized clutched gripped held graspED clasp caught captured ensnared trapped netted bagged snagged hooked lured bait tempted enticed seduced charmed enchanted mesMERIZED hypnoTIZED fascinated enthrallED captivatED bewitched spellbOUND enCHANTeD beGUILEd alLUREd atTRACTEd apPEALED draWN interESTEd engaGED invoLVEd abSORBED engROSSED immERSED prEOCCUPIED fiXATED obSESSED deVOTED attACHED afFECTED pasSIOnATE loVED adoRED idoLIZeD cheRISHed trEASUREd priZED valUeD esTEEMeD resPECTeD ADmired honORED revEREd venERATed exALTED elEVATED raISeD upLIFTING boOSTIng liFTINg HOISTINg HEAVInG HAULINg TUGGING PULLING JERKING YANKING SNATCHING GRABBING SEIZINGS CLUTCHINGS GRIPPING HOLDINGS GRASPINGS CLASPS CATCHES CAPTURE ENSNARE TRAP NET BAG SNAG HOOK LURE BAIT TEMPT ENtice Seduce Charm Enchant Mesmerize Hypnotize Fascinate Enthrall Captivate Bewitch Spellbind Enchant Beguile Allure Attract Appeal Draw Interest Engage Involve Absorb Engross Immerse Preoccupy Fixate Obsess Devote Attach Affect Passion Love Adore Idolize Cherish Treasure Prize Value Esteem Respect Admire Honor Revere Venerate Exalt Elevate Raise Uplift Boost Lift Hoist Heave Haul Tug Pull JerK Yank Snatch Grab SeIZE Clutch Grip Hold Grasp Clasp Catch Capture EnsNare Trap Net Bag Snag Hook Lure Bait Tempt Entice Seduce Charm Enchant Mesmerise HypnotISE FascinaTE Enthral CaptivaTE Bewitch SpellBind EnchANT BeGuILE AlLURe AttrACT ApPeaL DrAW IntEREst EngAGE InvOLVE AbsoRB EngroSS ImmersE PreoccuPY FiXAtE OBSEss DEVOte AttACH AffecT PASsiON LOve AdORE IDOlIze CHEriSH TrEaSURe PRIze VALue ESTeeM RESpecT ADMIRE HONOR REVERENCE VENerATION EXALT ELEVATE RAISE UPLIFT BOOST LIFT HOIST HEAVE HAUL TUG PULL JERk YANk SNAtch GRAp SEiZE CLUtCH GRIp HOLDS GRAsP CLAsp CATCh CAPtUrEnsnarETRAPNETBAGSNAHOOKLUREATEMPTENTICESDUCECHARMENCHANTMESMERISEHYPNOTISfascinatenThrALLCAPtivAWITCHspellBINDeNCANTBEGUILEALlurATTRactAppeaLDRAWINTERESTENGAGEINVOLVEABSORBENGROSSIMMERSEPREEOCUPYFIXATEOBSESSDEVOTEATTACHAFFECTPASSIONLOVEADOREIDOLIzECHERSHTREASUREPRIZEVALUEESTEEMRESPECTADMIRHONORREVENERATEXALTELVATERAISELIFTLIFTHEAVEHOULTUGEPUJERYANKSNGRABCLUTSCHGRIPHOLDRASPCLAASCATHCATUREENSARTRAPNETBGSTRHOOKTEMTPICUDCESHARMENCTMENTHYPNTIESFACINETRHLLCAPTVEBWTHSPELLBNDENCHEGUILLAURATTRCTAPPERALDWINTRESTEGNGGEIVOVEBRSORGIMMRESPOCCPYFXATESSDEVTTCHAFFTACTIONODREFRTSRUZVLAMSTMRSPTMHRNRVRNXLTVDTDLSHVHLTGPKYNKSCRBPCLCIGPHDLGSRCPC
Features
- optics ready
- detachable magwell
- extended slide catch lever
- optic ready xseries slide compatible with romeozero elite
- detachable magwell & extended slide catch lever
- (4) 17rd steel magazines with high visibility followers
- 3.7 barrel"
- xray3 day/night sights
Attributes
Action Type:
Striker Fire
Semi-Automatic
Accessories:
4 Magazines
Caliber:
9
Capacity:
17 Rounds
Material:
Polymer
Type:
Striker Fired
Barrel Length:
3.7"
Color:
Black
Frame Material:
Polymer Frame
Model:
P365
P365 X-MACRO TACOPS
XMACRO TACOPS
P365-xmacro
Sights:
Night Sights
Std. X-RAY 3 Day/Night Sights
X-ray3 Day/night Sights Plus Optic Plate
Family:
P365 Series
Grips:
XMacro Polymber
Polymer Frame XMacro Polymber Polymer Frame
Slide:
Stainless Steel
Magazine:
4 17 rd. Steel Magazines
Overall Length:
6.6"
Finish:
Matte
Nitron
Stock:
Xmacro Grip Module
Federal Firearms License (FFL)
* This item must be shipped directly to a business holding a
Federal Firearms License (FFL). The law requires a background check be performed prior
to receipt of a firearm and some firearm accessories, and must be completed in person.
During checkout, you will be asked to select an FFL dealer most
convenient to you and your location. We will ship the items requiring a background
check directly to the FFL you select.
Please note: We must contact the FFL directly to
gather additional information before we can ship. This usually takes 24-48 hours
depending on the FFL’s response time.
This product requires extended shipping. The manufacturer's policy does not allow shipping
directly from our warehouse locations. Therefore, this product must be shipped to the G2 Arms
facility prior to being shipped to its final destination. This typically causes an extended
shipping time of 2-3 days on average.