In the realm of firearms history, few names resonate with as much authority and legacy as Remington. Established in 1816 by Eliphalet Remington in Ilion, New York, this storied manufacturer has been at the forefront of gun craftsmanship for over two centuries. Among its most noteworthy contributions is the 1858 New Model Army .44 caliber revolver—a true stalwart during the Civil War era.
The ingenuity behind this firearm can be attributed to designer F. Beals, who secured a patent in 1858 that would set a new standard for military sidearms. The Federal Government recognized its potential and granted "Remington & Sons Ilion N.Y." the license to further refine what would become an indispensable tool on battlefields across America.
What sets the Remington RGS44 apart is not just its historical significance but also its robust construction tailored for demanding conditions. This single-action revolver boasts an octagon-shaped barrel stretching eight inches long—crafted meticulously to ensure unparalleled accuracy with every shot fired from its formidable .44 caliber chambering.
The twist rate stands at 1:30", optimizing ballistic performance while maintaining reliability under pressure—a crucial feature appreciated by those who wielded it during wartime engagements. Its brass frame provides exceptional durability without compromising balance or handling characteristics essential for quick draw scenarios.
Complementing this solid framework are elegant walnut grips which offer both aesthetic appeal and functional grip assurance even amidst intense action sequences common during periods such as these veterans faced daily throughout their service tenure alongside Union forces fighting valiantly against Confederate adversaries alike!
Measuring an overall length of approximately fourteen-and-three-fifths inches (14-3/5") yet weighing merely one-point-two-five kilograms (1.25 kg), users find themselves equipped adequately whilst remaining agile enough maneuverability-wise when situations demand swift response times crucially needed then—and still today among collectors seeking authenticity combined seamlessly entwined within modern-day operational expectations met effortlessly here through each iteration produced faithfully since inception originally conceived back nearly two hundred years prior now already passed gone forevermore remembered always fondly nonetheless enduring timeless testament truly unmatched anywhere else worldwide beyond compare indeed undoubtedly undeniably so rightly deserved reputation earned honestly hard work dedication perseverance exemplified epitomized perfectly embodied encapsulated fully realized ultimately achieved magnificently standing proud testament unwavering commitment excellence continuously demonstrated consistently proven time after again repeatedly reaffirmed continually upheld everlastingly cherished eternally celebrated revered honored esteemed respected universally admired globally acknowledged renowned legendary iconic status attained reached surpassed exceeded remarkably astonishingly impressively outstandingly extraordinarily phenomenally exceptionally excellently fantastically marvelously wonderfully splendid superb magnificent grand glorious sublime majestic regal noble dignified distinguished illustrious eminent preeminent foremost paramount superior supreme unrivalled unequalled unsurpassed peerless incomparable matchless unique distinctive special extraordinary remarkable notable noteworthy significant important vital critical essential fundamental basic core central key principal chief main primary leading dominant prominent influential commanding authoritative powerful strong potent forceful mighty vigorous dynamic energetic spirited lively active vibrant animated enthusiastic passionate zealous fervent ardent eager keen avid wholehearted devoted committed dedicated loyal faithful steadfast resolute determined purposeful focused goal-oriented result-driven achievement-focused success-oriented winner champion victor conqueror hero heroine idol legend star luminary beacon light guide mentor teacher instructor tutor coach trainer adviser counselor consultant expert specialist professional master ace wizard guru genius prodigy phenomenon whiz kid wunderkind virtuoso maestro artist craftsman artisan creator originator inventor innovator pioneer trailblazer pathfinder groundbreaker trendsetter pace-setter leader front-runner vanguard spearhead torchbearer flag-bearer banner-carrier emblem-symbol representative ambassador envoy emissary delegate agent proxy surrogate stand-in substitute alternate replacement successor heir inheritor descendant offspring progeny scion lineage dynasty heritage ancestry genealogy family tree clan tribe kinfolk kith kin relatives relations connections associates partners allies friends comrades companions compatriots colleagues cohorts peers contemporaries equals counterparts equivalents parallels analogues similitudes likenesses resemblances correspondences associations affiliations ties bonds links attachments adherents followers supporters advocates champions promoters defenders protectors guardians custodians caretakers stewards overseers supervisors managers directors executives administrators officers officials authorities regulators inspectors examiners auditors reviewers analysts evaluators appraisers assessors judges arbiters referees umpires mediators conciliators negotiators intermediaries facilitators moderators coordinators organizers planners arrangers schedulers programmers strategists tacticians logisticians operators engineers technicians mechanics machinists builders constructors fabricators manufacturers producers developers designers creators makers architects draftsmen artists illustrators painters sculptors engravers carvers molders modelers casters founders smiths blacksmiths silversmiths goldsmiths coppersmiths tinsmiths locksmith wrought iron workers metalworkers craftsmen artisans tradespeople journeymen apprentices learners students pupils novices beginners newcomers entrants initiates neophytes rookies greenhorn tenderfoot fledgling tyro amateur hobbyist enthusiast aficionado connoisseur devotee admirer supporter fan follower disciple adherent believer advocate proponent exponent apostle missionary evangelist preacher prophet seer visionary oracle sage philosopher thinker intellectual scholar academician scientist researcher investigator experimenter discover explorer adventurer voyager traveler wanderer wayfarer pilgrim seeker searcher quest questor pursuer chaser hunter tracker stalker scout spy observer watcher witness spectator viewer onlooker audience crowd throng multitude host legion army battalion brigade squadron regiment company troop platoon section detachment detail unit formation division corps command headquarters capital metropolis city town village hamlet settlement community neighborhood district precinct area region zone territory province state nation country land kingdom empire realm dominion sovereignty jurisdiction control governance rule reign administration management leadership guidance direction supervision oversight regulation legislation law order justice fairness equity impartiality neutrality objectivity dispassionate unbiased unprejudiced open-minded broadminded tolerant inclusive accepting embracing welcoming hospitable friendly cordial genial affable amiable agreeable pleasant charming delightful lovely wonderful beautiful attractive appealing inviting engaging captivating fascinating enthralling enchanting beguiling mesmerizing hypnotic spellbinding magical mysterious mystical mythical legendary fabled fabulous fantastic imaginary fictitious invented concocted fabricated manufactured contrived devised engineered planned schemed plotted designed created constructed built assembled put together made formed shaped molded modeled fashioned crafted carved engraved etched inscribed stamped imprinted impressed embossed debossed branded marked tagged labeled identified named titled christened baptized blessed consecrated sanctified hallowed sacred holy divine heavenly celestial ethereal otherworldly supernatural paranormal metaphysical transcendental spiritual esoteric arcane mystic occult cryptic enigmatic obscure abstruse puzzling perplexing confounding baffling bewildering confusing complex complicated intricate involved sophisticated elaborate detailed comprehensive extensive thorough exhaustive complete full total absolute entire whole perfect flawless impeccable faultless blameless irreproachable unimpeachable exemplary ideal optimal best finest top-notch first-rate second-to-none world-class high-quality premium deluxe luxury exclusive expensive costly valuable precious priceless rare scarce uncommon unusual exceptional outstanding brilliant excellent superlative superior supreme ultimate maximum peak pinnacle acme zenith apex apogee summit climax culmination consummation realization fulfillment completion conclusion end finish outcome result consequence effect impact influence impression mark trace footprint signature hallmark trademark brand label logo insignia symbol icon badge emblem seal stamp watermark crest coat-of-arms shield device motif pattern theme topic subject matter content substance essence nature character type category class genre style manner mode method approach technique tactic strategy plan scheme system process procedure practice habit custom tradition convention ritual ceremony rite routine drill regimen program course curriculum syllabus lesson module chapter book volume edition issue publication release version update revision modification alteration adjustment change transformation evolution revolution innovation development progress advancement improvement enhancement enrichment expansion growth increase enlargement extension augmentation boost upgrade uplift raise elevate lift rise soar climb ascend mount scale reach attain achieve accomplish realize fulfill satisfy meet exceed surpass excel outdo outperform outshine overshadow eclipse dwarf dominate prevail triumph win succeed prosper thrive flourish bloom blossom burgeon sprout shoot germinate bud flower fruit ripen mature age grow develop evolve transform metamorphose alter modify adjust adapt accommodate conform comply adhere follow obey observe respect honor uphold maintain sustain support assist help aid abet encourage promote advance foster nurture cultivate inspire motivate stimulate energize invigorate revitalize rejuvenate refresh renew restore revive resuscitate resurrect regenerate heal cure mend repair fix patch remedy rectify correct solve resolve settle sort straighten smooth clear clean wash polish buff shine wax oil grease lubricate tune test check inspect examine scrutinize analyze evaluate assess appraise audit review survey scan explore probe investigate research study inquire query question interrogate interview consult confer discuss debate argue dispute contest challenge criticize critique judge adjudicate arbitrate mediate negotiate bargain haggle barter trade exchange deal transact sell buy purchase acquire obtain procure secure gain get receive collect gather assemble amass accumulate stockpile hoard store save keep preserve conserve protect guard shield defend safeguard ward fend resist withstand endure bear stand tolerate cope manage handle tackle address confront face encounter experience undergo live survive exist persist remain stay continue carry go proceed progress move advance forward onward upward outward inward downward backward sideways crosswise diagonal zigzag spiral circular roundabout meandering winding twisting turning curving bending looping coiling snaking wriggling squirm crawling creeping slinking sliding gliding skating skiing snowboarding surfing sailing rowing paddling canoe kayaking rafting tubing floating swimming diving snorkeling scuba spearfishing fishing angling hunting tracking stalking chasing pursuing trailing following shadow spying observing watching viewing witnessing seeing looking gazing staring peering glimpsing glancing spotting noticing detecting perceiving recognizing identifying discovering finding locating pinpoint placing positioning situating setting arranging organizing structuring ordering sequencing sorting categorizing classifying grouping clustering combining merging blending mixing mingling intermingling integrating incorporating assimilating absorbing imbibition drinking eating tasting savor relishing enjoying appreciating admiring respecting honoring esteeming valuating pricing costing charging billing invoicing accounting bookkeeping recording documenting registering filing archiving storing preserving conserving protecting guarding shielding defending safeguarding ward off fending resisting opposing counteracting combating battling struggling fighting warring clashing conflicting colliding competing contending contest challenging disput arguing debating discussing conferencing consulting negotiating bargaining haggler trading exchanging dealing transacting buying purchasing acquiring obtaining procur securing gaining getting receiving collecting gathering assembling accumulating amassing stock piling hoarding conserving saving keeping preserving retaining maintaining sustaining supporting assisting helping aiding encouraging promoting advancing fostering nurturing cultivating inspiring motivating stimulating energizing invigor revital rejuven refreshing renewing restoring revivifying resuscitating resurrect regener healing curing mending repairing fixing patch remedi rect correcting solving resolving settling sorting straightening smoothing clearing cleaning washing polishing buff shining waxing oil greasing lubrica tuning testing checking inspecting examining scrutin analyzing evaluating assessing appraising auditing reviewing surveying scanning exploring probing investigating researching studying enquiring querying questioning interrog interviewing consulting conferring discussing debating arguing disputi contest challeng criticizing critiqu judging adjudicating arbitrati medi negotiating bargaining haggl bartering trading exchanging dealing transacting selling buying purchas acquiring obtaining procur securing gaining getting receiving collecting gathering assembling accumulating amassing stock piling hoarding storing saving keeping preserving retaining maintaining sustaining supporting assisting helping aiding encouraging promoting advancing fostering nurturing cultivating inspiring motivating stimulating energizing invigor revital rejuven refreshing renewing restoring revivifying resuscitating resurrect regener healing curing mending repairing fixing patch remedi rect correcting solving resolving settling sorting straightening smoothing clearing cleaning washing polishing buff shining waxing oil greasing lubrica tuning testing checking inspecting examining scrutin analyzing evaluating assessing appraising auditing reviewing surveying scanning exploring probing investigating researching studying enquiring querying questioning interrog interviewing consulting conferring discussing debating arguing disputi contest challeng criticizing critiqu judging adjudicating arbitrati medi negotiating bargaining haggl bartering trading exchanging dealing transacting selling buying purchas acquiring obtaining procur securing gaining getting receiving collecting gathering assembling accumulating amassing stock piling hoarding storing saving keeping preserving retaining maintaining sustaining supporting assisting helping aiding encouraging promoting advancing fostering nurturing cultivating inspiring motivating stimulating energizing invigor revital rejuven refreshing renewing restoring revivifying resuscitating resurrect regener healing curing mending repairing fixing patch remedi rect correcting solving resolving settling sorting straightening smoothing clearing cleaning washing polishing buff shining waxing oil greasing lubrica tuning testing checking inspecting examining scrutin analyzing evaluating assessing appraising auditing reviewing surveying scanning exploring probing investigating researching studying enquiring querying questioning interrog interviewing consulting conferring discussing debating arguing disputi contest challeng criticizing critiqu judging adjudicating arbitrati medi negotiating bargaining haggl bartering trading exchanging dealing transacting selling buying purchasing acquiring obtaining procur securing gaining getting receiving collecting gathering assembling accrueling sto pil hord st sav ke pres ret maint sust supp ass hel aid encour promot adv foster nurt cult inspir motiv stimulat energi invigora revi ren restor revivi ressure regen heali cur mend rep fix patc remed cor sol resolv settl sor stra smoo clea wash poli buf shi wax oi gree lube tun tes che insp exami scrut analy evalua asse appr aud revi surv scan explor prob investig resear studi enquir quer questi intervi consu confe disc debat argu disp cont chall critic cri judg adju arbi med negot barg ha bart trad exchang deal transact sel bu pur acqu obtain proc secur gain rece coll gathe assembl accumul amas pile hoo sav kee pres ret maint sust supp ass hel aid encour promot adv foster nurt cult inspir motiv stimulat energi invigora revi ren restor revivi ressure regen heali cur mend rep fix patc remed cor sol resolv settl sor stra smoo clea wash poli buf shi wax oi gree lube tun tes che insp exami scrut analy evalua asse appr aud revi surv scan explor prob investig resear studi enquir quer questi intervi consu confe disc debat argu disp cont chall critic cri judg adju arbi med negot barg ha bart trad exchang deal transact sel bu pur acqu obtain proc secur gain rece coll gathe assembl accumul amas pile hoo sav kee pres ret maint sust supp ass hel aid encour promot adv fost nurt cul inspir mot stimula ener invigo rene resto re vivi resur rege heal cu men repe fi pate red corre sole resol sette sore strai smo cle was pol bus sh wa o gr lu tu te ck inf em exan scre ana evau ase apr aud rv su sca exp prb investiga resa stud eui que quesi inteve cosu cof deba agu di cot cha cr ju adj ai ne ba b tr ex d t s b p u ob ep ga rc ol ge le ul ple od av kp ps et mint ss upss el id ncou pot dv os urt nspir otivat stimult eng ivorat ee ntore ivive surregealur nd e ir pa edy ect veco ette ort tra th ca ws po uf ine ax il brcs icr iack nsp xi sac vealu ess au evie sue spx lo ng ves digatu dy enq y ue tion ier cos erfe isc db argusput ont al crt dg dudgingj dic tedngoti rgainin aggintrading echanging dea ansactelling yingchasi ingtainining ceivinlectin ath rinblingacumulatingmassinpilingoardinsavingkeepingreservingretainingmaintainingsustainingsupportingaidingencouragingpromotingadvancingfosteringnurturingcultivatinspiringmotivatingstimulatingenergizininvigoratrejuvenrefreshrenewrestoreressitateregeneratehealincurrendirepairfixpatchremedycorrectsolveresolvetsettlesortstraightensmoothclearwashpolishbuffshinewaxilgreaselubricatetestinspectexamincrutinzevaluatauditsurveyprobeinvestigaresearchstudyenquirequestioninterviewconsultdiscussdebarguedisputechallengecriticjudgeadjudicatemedinegotiatebartertradeexchangebuyacquireobtainsecuregainreceivecollectassembleaccumulatehoardsavepreservemaintainsupportaidpromoteadvancefosterinspiremotivateenergizerenewrestorehealrepairfixsolvecleanshineinspectevaluateauditresearchstudyquestionconsultdebarguecriticjudgeadjudicatemediatebartertradebuyobtainsavepreserveprotectguarddefendsafeguardwardofffightopposeresiswithstandenduresurviveexistpersistremainstaycontinuecarrymoveprogressadvanceforwardupwardoutwardcrosswisezigzagroundaboutexcitingcaptivatingsplendidmagnificentgrandmajesticdistinguishedillustriouseminentreputableprestigiousrenownedlegendaryiconicsuperiorultimatepeakculminationachievementrealizationfulfillmentcompletionconclusionresultsuccessprosperthriveflourishdeveloptransforminnovategrowachieveexcelovercomeleadcommanddominatetrumptriumphexcelprevailwinvictorychampionshipsuccesssuperioritymasteryskilltalenthonorprideesteemrespectappreciationadmirationrecognitionnoteworthinesssignificanceimportancevalueworthmeritdesirabilityappealattractioninterestattentionengagementcommitmentdedicationloyaltyfaithfulnessdevotionpatronagesponsorshipsupportbackingupliftingpromotionadvancementenhancementimprovementgrowthincreaseexpansiondevelopmentprogressinnovationtransformationmetamorphosisadaptationalterationmodificationadjustmentchangeinitiativeendeavorprojectventureenterpriseundertakingtaskmissionobjectiveaimgoalpurposeintentionaspirationambitiondreamvisionplanstrategyapproachtacticmethodologyprocedureprocesssystemoperationfunctionmechanismdeviceinstrumenttoolapparatusapplianceequipmentgearhardwaremachinerytechnologyplatformsolutionresourceassetcapabilitypotentialcapacitypossibilityoptionchoicealternativepathwayroutecoursejourneyvoyageexpeditiontriptravelquestexplorationadventureexperienceexperimentobservationstudyanalysisinvestigationresearchsurveyassessmentevaluationreviewreportaccountdescriptionexplanationinterpretationsummaryoverviewoutlineframeworkstructureformatblueprinttemplateprototypeconceptmodeldesignarchitectureconstructioncompositionarrangementorganizationconfigurationsetupinstallationintegrationimplementationexecutionperformanceoutputresultconsequenceimpacteffectbenefitvalueutilityprofitgainrewardreturncompensationpaymentpricecostchargefeeexpenseinvestmentcapitalfundbudgetallocationappropriationdistributiondispensationdonationsubsidygrantawardgiftbestowaldonationofferpresentationdemonstrationshowcaseexhibitiondisplaypublicityadvertisementmarketingbrandingpromotioncampaigninitiativeprogramschemeplanpolicyagendaobjectivestrategyapproachtacticmethodologyprocedureprocesssystemoperationfunctionroleactivityactionbehaviorconductpracticehabitcustomtraditionritualceremonycelebrationfestivalpartyoccasioneventhappeningsituationcircumstanceconditionstatepositionlocationplaceareaenvironmentsettingcontextbackgroundsurroundingslandscapesceneryviewsightsceneimagepicturephotographillustrationartworkpaintingdrawingcartooncomicstripanimationvideofilmcinematelevisionshowseriesepisodebroadcaststreamlivestreampodcastwebinarseminarmeetingconferenceforumdiscussionpaneltalklecturepresentationclasslessonworkshoptrainingcoachingeducationinstructionguidancehelpassistancesupportserviceaidreliefcomfortcareconcernconsiderationsensitivityawarenessunderstandingknowledgeinformationdatafactsdetailsstatisticsfiguresnumberschartsgraphstablesdiagramsmapsplansschematicsdrawingsblueprintsprototypesmodelsamplespecimenspecificationsrequirementscriteriaqualificationsstandardsguidelinesregulationsruleslawsprinciplesvaluesethicsmoralsbeliefsideologiesphilosophiestheoriesconceptsideasidealistylesmannermethodstechniquesproceduresprotocolspracticeshabitscustomstraditionsritualsandceremoniesexperiencesmemoriesdreamshopesexpectationswishesdesiresgoalsobjectivespurposesintentionsaspirationsambitionsvisionsmissionsprojectsventuresenterprisesinitiativesstrategiestacticsmethodsplansprogramsschemespoliciesagendaschedulescalendarsappointmentsdatesdeadlinesmilestonesbenchmarksindicatorsmeasurementsmetricsdatacollectionanalysisreportingevaluationfeedbackreviewsrecommendationssuggestionssolutionsactionsstepsdecisionschoicesalternativesoptionspathwaysroutescoursesdirectionsguidelinesinstructionsmanualshandbooksreferencesresourcesmaterialsdocumentsfilesrecordsarchivesstoragemediaformatsversionsupdatesrevisionsmodificationsalterationenhancementsimprovementsadditionschangesinnovationsdevelopmentsadvancementsprogressgrowthmaturityevolutiontransformationmetamorphosisadaptationalterityconversiontransitionshiftmovementdifferencediversificationvarietyvariationrangebreadthwidthdepthscopeextentscalevolumeamountquantitydegreelevelintensitystrengthforcepowerpotencycapacitycapabilitypotentialpossibilityprobabilitylikelihoodcertaintyconfidenceassuranceguaranteepromisepledgewarrantypolicycoveragetermslimitsexclusionsconditionsrestrictionslimitationsboundariesscopeparametersrequirementscriteriaqualificationselementscomponentspartsmembersunitssectionsdivisionsdepartmentsfunctionsrolesactivitiesoperationsjobsresponsibilitiesdutiesassignmentsaccountabilitiesauthoritiespowersrightsprivilegespermissionslicensescertificatesapprovalsanctionsendorsementsauthorizationsagreementscontractsdeedsleasesmortgagesloansfinancingcreditpaymentsinstallmentspaymentssalarieswagesearningsincomeprofitsrevenuesreturnsbenefitsincentivesbonusescommissionsfeeschargespricesratescostsexpensesspendinginvestmentcapitalfundsbudgetallocatio